PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024187-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 330aa    MW: 35964.5 Da    PI: 8.817
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024187-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.7e-191358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
    NNU_024187-RA 13 KGPWSPEEDDALQKLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58
                     79******************************.***********985 PP

2Myb_DNA-binding56.46.7e-1867109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
    NNU_024187-RA  67 AFTPEEDETIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 109
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.703863IPR017930Myb domain
SuperFamilySSF466892.7E-3210106IPR009057Homeodomain-like
SMARTSM007171.6E-171261IPR001005SANT/Myb domain
PfamPF002492.8E-191358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-261466IPR009057Homeodomain-like
CDDcd001671.34E-161557No hitNo description
SMARTSM007173.4E-1564112IPR001005SANT/Myb domain
PROSITE profilePS5129421.9365114IPR017930Myb domain
PfamPF002494.0E-1567109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2467113IPR009057Homeodomain-like
CDDcd001671.51E-1267110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MSSSSRKDQD RIKGPWSPEE DDALQKLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS  60
PQVEHRAFTP EEDETIIRAH AKFGNKWATI ARLLSGRTDN AIKNHWNSTL KRKCSSMTDE  120
GSVDGHVNQP LKRSVSAGAA IPPVSALYLS SPSSPSGSDV SDSSLPVISP SHVYRPVART  180
GGILPPQQQQ QPQLETSSST NDPPTSLSLS LPGADSCEAS NHVPGSNHAT NPSQPSQLAS  240
SLSLPPPTVV PLQQVSQPPH HTEYNEFATS APPAEKPFMP FCPEFLSVMQ EMIKKEVRNY  300
MLGLEQNGLC FRADGIRNAV VKRIGISKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-41121133104C-Myb DNA-Binding Domain
1msf_C5e-41121133104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244270.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW13e-93MYB44_ARATH; Transcription factor MYB44
TrEMBLF6HSY71e-165F6HSY7_VITVI; Putative uncharacterized protein
STRINGVIT_07s0129g01050.t011e-165(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-87myb domain protein 73